Analytical Data
-
Gene name
GPR43
- Application
-
Alternative Names
FFAR2; FFA2; GPCR43; GPR43; Free fatty acid receptor 2; G-protein coupled receptor 43
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15552
-
Expression Region
1-330aa
-
AA Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
-
Molecular Weight
63.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR43, also known as free fatty acid receptor 2 (FFAR2), is a member of the G protein-coupled receptor (GPCR) family that has garnered significant attention in recent years due to its role in various physiological processes, particularly in immunology and metabolism. It is activated by short-chain fatty acids (SCFAs), which are produced by the fermentation of dietary fibers by gut microbiota. Research has shown that GPR43 is involved in regulating inflammation, insulin sensitivity, and appetite, highlighting its potential as a therapeutic target for conditions such as obesity, diabetes, and inflammatory diseases. As a receptor that mediates important signaling pathways, the study of GPR43 and its recombinant proteins aids in understanding its functional mechanisms and interactions within biological systems. The development of recombinant GPR43 proteins facilitates high-throughput screening of ligands, functional assays, and the exploration of receptor structure-function relationships. This research background sets the stage for investigating GPR43's therapeutic implications, as well as the development of novel drugs aimed at modulating its activity to treat metabolic disorders and inflammatory diseases. Given its emerging significance, the continued study of GPR43 and its recombinant proteins promises to contribute valuable insights into the regulation of metabolism and immune responses, potentially paving the way for innovative therapeutic strategies.
