Analytical Data
-
Gene name
GPR42
- Application
-
Alternative Names
GPR42; GPR42P; G-protein coupled receptor 42
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15529
-
Expression Region
1-346aa
-
AA Sequence
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLVAATLLNFLVCFGPYNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN
-
Molecular Weight
38.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR42, a member of the G protein-coupled receptor (GPCR) family, has garnered attention due to its potential role in various physiological processes and its implications in metabolic disorders. Studies have shown that GPR42 is involved in the regulation of immune responses and inflammatory pathways, indicating its significance in conditions such as obesity, diabetes, and cardiovascular diseases. Furthermore, GPR42 is activated by short-chain fatty acids (SCFAs), which are produced during the fermentation of dietary fibers by gut microbiota. This activation suggests a crucial link between diet, gut health, and metabolic regulation. The recombinant protein of GPR42 is essential for elucidating the receptor's structure-function relationships and for exploring its interactions with SCFAs and other ligands. Producing this protein in a laboratory setting allows researchers to conduct detailed biochemical assays and structural analyses, ultimately paving the way for the development of novel therapeutic strategies targeting metabolic and inflammatory diseases. The recombinant GPR42 protein serves as a valuable tool for drug discovery and the understanding of the receptor's biological role, thereby contributing to the growing body of knowledge in GPCR biology and its potential therapeutic applications.
