Analytical Data
-
Gene name
GPR182
- Application
-
Alternative Names
GPR182; ADMR; G-protein coupled receptor 182
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15218
-
Expression Region
1-404aa
-
AA Sequence
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
-
Molecular Weight
46.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR182, or G protein-coupled receptor 182, is a member of the largest family of membrane proteins involved in various physiological processes, including immune response, cell signaling, and metabolism. Recent studies have highlighted its potential role in the modulation of inflammatory responses and its implications in various diseases, such as cancer and autoimmune disorders. The research on GPR182 recombinant proteins has gained traction due to the receptor's emerging significance in therapeutic development. Understanding the structural and functional characteristics of GPR182 is crucial for elucidating its mechanisms of action and for identifying potential drug targets. Generating recombinant GPR182 proteins allows researchers to investigate the receptor's binding affinity, intracellular signaling pathways, and interactions with ligands. Additionally, these studies can aid in the design of selective modulators that could serve as novel therapeutic agents. The advancement of techniques such as CRISPR gene editing and advanced protein engineering has facilitated the exploration of GPR182, paving the way for innovative strategies to manipulate its activity in clinical settings. Overall, the study of GPR182 recombinant proteins is vital for uncovering their roles in health and disease, fostering the development of new treatments targeting this receptor.
