Analytical Data
-
Gene name
lpqE
- Application
-
Alternative Names
lpqE；Putative lipoProtein LpqE
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WK62
-
Expression Region
30-182aa
-
AA Sequence
CGAGQISQTANQKPAVNGNRLTINNVLLRDIRIQAVQTSDFIQPGKAVDLVLVAVNQSPDVSDRLVGITSDIGSVTVAGDARLPASGMLFVGTPDGQIVAPGPLPSNQAAKATVNLTKPIANGLTYNFTFKFEKAGQGSVMVPISAGLATPHE
-
Molecular Weight
23.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of lpqE, a gene found in the bacterium Mycobacterium tuberculosis, has gained significant attention due to its potential role in the pathogenicity and survival of this notorious pathogen. LpqE encodes a lipoprotein that is involved in the biogenesis of the bacterial cell envelope and may play a crucial role in immune evasion. Understanding the structure and function of lpqE is essential, as it might serve as a target for novel tuberculosis therapies and vaccine development. Previous research has indicated that lpqE interacts with the host's immune system, potentially influencing the persistence of Mycobacterium tuberculosis in human tissues. The recombinant expression of lpqE allows for detailed analysis of its biochemical properties and interactions, facilitating insights into its function and role in infection. Additionally, isolating the lpqE protein in a controlled environment provides opportunities to study its immunogenicity, which is vital for exploring its potential as a vaccine candidate. Overall, the investigation of lpqE and its recombinant protein form is critical in the broader context of tuberculosis research, aiming to unveil new strategies for combating this global health challenge. As researchers continue to dissect the complex mechanisms underlying mycobacterial infections, lpqE remains a promising focus that could lead to improved diagnostics and therapeutics for tuberculosis.
