Analytical Data
-
Gene name
GPR17
- Application
-
Alternative Names
GPR17; Uracil nucleotide/cysteinyl leukotriene receptor; UDP/CysLT receptor; G-protein coupled receptor 17; P2Y-like receptor; R12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13304
-
Expression Region
1-339aa
-
AA Sequence
MNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDFILALVGNTLALWFFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVAFTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFVAEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL
-
Molecular Weight
63.03 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR17 is a G protein-coupled receptor that has garnered significant attention in recent years due to its potential roles in various physiological and pathological processes, including myelination, neuroinflammation, and neurodegenerative diseases. It is notable for its dual activity, serving as a sensor for both purines and lipids, which places it at the intersection of metabolic and signal transduction pathways. Studies have indicated that GPR17 can modulate oligodendrocyte differentiation and myelin formation, highlighting its relevance in neurodevelopment and repair mechanisms following injury. Additionally, its involvement in the regulation of inflammatory responses suggests a potential therapeutic target for conditions like multiple sclerosis and other neuroinflammatory disorders. Given the receptor's multifaceted roles, the production and characterization of recombinant GPR17 protein are critical for elucidating its biological functions and mechanisms of action. Recombinant GPR17 proteins can be utilized in various experimental approaches, such as binding assays and functional assays, to explore ligand-receptor interactions and downstream signaling pathways. This research may pave the way for the development of novel therapeutic interventions targeting GPR17 in neurological diseases, thereby contributing to the broader understanding of receptor biology and its implications in health and disease. The ongoing investigation into GPR17 not only highlights its significance in the nervous system but also underscores the importance of receptor research in developing targeted therapies for complex disorders.
