Analytical Data
-
Gene name
GPR12
- Application
-
Alternative Names
GPR12; G-protein coupled receptor 12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47775
-
Expression Region
1-334aa
-
AA Sequence
MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
-
Molecular Weight
63.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR12, a member of the G protein-coupled receptor (GPCR) family, has garnered significant attention in research due to its role in neurobiology and potential implications in various diseases. GPCRs are integral to numerous physiological processes and are key targets in drug development, making the study of their functions and mechanisms critical. GPR12 is primarily expressed in the brain and is associated with the regulation of neurotransmitter systems, influencing mood, cognition, and behavior. Preliminary studies suggest that GPR12 may play a role in neurodegenerative disorders and psychiatric conditions, highlighting its therapeutic potential. Recent advancements in recombinant protein technology have facilitated the production of GPR12 in heterologous systems, providing researchers with the tools needed to elucidate its structure and function. Characterizing the GPR12 recombinant protein enables the exploration of its signaling pathways and interactions with ligands, which are crucial for understanding its biological activity. Moreover, insights gained from these studies could lead to the development of novel therapeutic strategies targeting GPR12-related pathways, paving the way for innovative treatments for conditions such as depression, anxiety, and neurodegeneration. As research progresses, the unique properties of GPR12 present both challenges and opportunities in the field of pharmacology and molecular neuroscience, making it a compelling subject for further investigation.
