Cat: PA2000-8020

Recombinant Human GOLT1B Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GOLT1B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GOLT1B; GCT2; GOT1A; CGI-141; HDCMA39P; UNQ432/PRO793; Vesicle transport protein GOT1B; Germ cell tumor 2; Golgi transport 1 homolog B; Putative NF-kappa-B-activating protein 470; hGOT1a

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y3E0

  • Expression Region

    1-138aa

  • AA Sequence

    MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV

  • Molecular Weight

    40.92 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GOLT1B (Golgi Transport 1B) is a protein that plays a critical role in the intracellular transport and processing of glycoproteins within the Golgi apparatus, a key organelle in the secretory pathway. Understanding the function and mechanism of GOLT1B is essential as it is implicated in various cellular processes, including protein sorting, glycosylation, and overall secretory pathway efficiency. Recent research has highlighted its potential links to diseases such as cancer and neurodegenerative disorders, where disruptions in Golgi function can lead to aberrant protein processing and homeostasis. The recombinant expression of GOLT1B allows researchers to explore its structural and functional properties in detail, fostering insights into its role in cellular biology. By investigating the biochemical characteristics and interaction networks of GOLT1B, scientists aim to elucidate its precise contribution to Golgi dynamics and its potential as a therapeutic target. This background underscores the significance of GOLT1B in both basic biological research and its implications for understanding disease mechanisms, highlighting the importance of developing recombinant versions of this protein for further study.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US