Analytical Data
-
Gene name
GOLT1B
- Application
-
Alternative Names
GOLT1B; GCT2; GOT1A; CGI-141; HDCMA39P; UNQ432/PRO793; Vesicle transport protein GOT1B; Germ cell tumor 2; Golgi transport 1 homolog B; Putative NF-kappa-B-activating protein 470; hGOT1a
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3E0
-
Expression Region
1-138aa
-
AA Sequence
MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV
-
Molecular Weight
40.92 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GOLT1B (Golgi Transport 1B) is a protein that plays a critical role in the intracellular transport and processing of glycoproteins within the Golgi apparatus, a key organelle in the secretory pathway. Understanding the function and mechanism of GOLT1B is essential as it is implicated in various cellular processes, including protein sorting, glycosylation, and overall secretory pathway efficiency. Recent research has highlighted its potential links to diseases such as cancer and neurodegenerative disorders, where disruptions in Golgi function can lead to aberrant protein processing and homeostasis. The recombinant expression of GOLT1B allows researchers to explore its structural and functional properties in detail, fostering insights into its role in cellular biology. By investigating the biochemical characteristics and interaction networks of GOLT1B, scientists aim to elucidate its precise contribution to Golgi dynamics and its potential as a therapeutic target. This background underscores the significance of GOLT1B in both basic biological research and its implications for understanding disease mechanisms, highlighting the importance of developing recombinant versions of this protein for further study.
