Analytical Data
-
Gene name
FABP9
- Application
-
Alternative Names
FABP9MRG;Fatty acid-binding Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q0Z7S8
-
Expression Region
1-132aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMVEPFLGTWKLVSSENFEDYMKELGV NFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEEFDETTA DNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVST RIYEKV
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FABP9, or Fatty Acid-Binding Protein 9, is a member of the FABP family, known for its role in the intracellular transport of long-chain fatty acids and other lipid molecules. Research into FABP9 is particularly relevant due to its association with various metabolic processes and diseases, including obesity, diabetes, and cardiovascular disorders. Recent studies have highlighted FABP9’s involvement in regulating inflammation and immune responses, suggesting its potential as a biomarker for metabolic conditions and a target for therapeutic interventions. The recombinant production of FABP9 allows for detailed structural and functional analyses, enabling scientists to elucidate its mechanisms of action and interaction with fatty acids. This foundational knowledge is crucial for understanding its physiological significance and developing strategies to manipulate its pathways for disease prevention and treatment. Additionally, given the increasing prevalence of metabolic diseases worldwide, exploring and harnessing the properties of FABP9 through recombinant technology could open new avenues for innovative therapies aimed at managing these conditions more effectively.
