Analytical Data
-
Gene name
BEND3
- Application
-
Alternative Names
BEND3；KIAA1553；BEN domain-containing Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T5X7
-
Expression Region
328-461aa
-
AA Sequence
CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD
-
Molecular Weight
17.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BEND3, or Bender homology protein 3, is a member of the BEND family of proteins, which are characterized by their roles in chromatin remodeling and gene expression regulation. The research into BEND3 has gained momentum due to its implications in various biological processes and diseases, including cancer and developmental disorders. It is known to play a pivotal role in modulating the architecture of chromatin and influencing transcriptional activity, thereby affecting cellular differentiation and proliferation. Studies have shown that BEND3 interacts with various transcription factors and chromatin-modifying complexes, suggesting its integral role in the transcriptional regulation network. Furthermore, recent investigations have highlighted its potential involvement in epigenetic modifications, raising interest in its function as a biomarker for certain diseases. As the understanding of BEND3's mechanism of action in cellular contexts grows, it could emerge as a novel therapeutic target, paving the way for innovative strategies in treating diseases associated with dysregulated gene expression. Thus, ongoing research aims to elucidate the biological pathways influenced by BEND3, investigate its structural characteristics, and assess its role in various cellular and pathological processes.
