Analytical Data
-
Gene name
GNLY
- Application
-
Alternative Names
GNLY;LAG2;NKG5;TLA519;Granulysin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22749
-
Expression Region
23-145aa
-
AA Sequence
RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTI VQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGL VAGETAQQICEDLRLCIPSTGPL
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNLY (Granulysin) is a cytolytic protein primarily produced by natural killer (NK) cells and cytotoxic T lymphocytes, playing a crucial role in the immune response against infections and tumors. This 15-kDa protein exhibits antimicrobial activity against various pathogens, including bacteria, fungi, and parasites, making it an essential component of the host defense mechanism. In recent years, research has focused on the potential therapeutic applications of GNLY, particularly in oncology, as it can induce apoptosis in tumor cells. Its mechanism of action involves the formation of pores in target cell membranes, leading to cell lysis. Additionally, GNLY's ability to enhance immune responses suggests its potential as an adjuvant in vaccine development. Given the increasing prevalence of multidrug-resistant pathogens and the limited efficacy of conventional therapies, understanding the structure-function relationship of GNLY and its role in immune modulation could pave the way for novel treatments. Current studies are exploring recombinant GNLY as a therapeutic agent, investigating its stability, efficacy, and potential synergistic effects when combined with other immunotherapeutic strategies. Overall, the research into GNLY and its recombinant forms represents a promising frontier in immunology and infectious disease treatment.











