Analytical Data
-
Gene name
GZMM
- Application
-
Alternative Names
GZMM；MET1；Granzyme M
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51124
-
Expression Region
1-257aa
-
AA Sequence
MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHL CGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHP RYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGW GLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQ APCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIR KVTGRSA
-
Molecular Weight
27.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GZMM (Granzyme M) is a serine protease primarily expressed in cytotoxic lymphocytes, playing a critical role in the immune response against infected or malignant cells. Research on GZMM has gained momentum due to its unique ability to induce apoptosis in target cells, making it a potential therapeutic target for cancer immunotherapy. Unlike other granzymes, GZMM exhibits distinct substrate specificity and activation mechanisms, which raises questions about its functional roles in immune regulation and its pathways involved in modulating tumor microenvironments. Recent studies have highlighted its prognostic significance in various cancers and its interaction with different molecular pathways, pointing towards its potential as a biomarker for cancer progression and treatment response. Additionally, the recombinant expression of GZMM allows for detailed biochemical studies, aiding in understanding its structure-function relationships and paving the way for innovative strategies that leverage its apoptotic properties in cancer treatments. Exploring GZMM's mechanisms may not only enhance our understanding of immune evasion by tumors but also contribute to the development of novel immunotherapeutic approaches that could improve patient outcomes in oncology.
