Cat: PA1000-1009

Recombinant Human ELP4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ELP4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ELP4;C11orf19;PAXNEB;Elongator complex Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96EB1

  • Expression Region

    1-424aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAAVATCGSVAASTGSAVATASKSNVT SFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGG LAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQ ELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSS SRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKL LQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGN SHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGL ESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKL FTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHLDF

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ELP4, or elongator protein 4, is a crucial component of the elongator complex involved in the regulation of transcription and mRNA processing. This protein plays a significant role in various cellular processes, including gene expression, chromatin remodeling, and RNA modification. Research into ELP4 has gained momentum due to its association with certain diseases, such as neurodegenerative disorders and cancer. Mutations or dysregulation of ELP4 are linked to impaired neuronal function and cell proliferation. Moreover, ELP4 has been implicated in the modification of transfer RNAs, which are essential for protein synthesis, thereby affecting translational fidelity and efficiency. Understanding the structure and function of ELP4, as well as its interactions with other molecular partners, provides valuable insights into its biological role and potential therapeutic targets. Recent advancements in recombinant protein technology have facilitated the study of ELP4, enabling researchers to express and purify this protein for detailed biochemical and functional analyses. The exploration of ELP4's activity, regulation, and involvement in various signaling pathways could lead to novel strategies for drug development and intervention in diseases associated with its dysfunction. Overall, ELP4 is an important molecule in the field of molecular biology, and ongoing research aims to clarify its diverse roles within the cell, contributing to the broader understanding of cellular homeostasis and pathogenesis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US