Analytical Data
-
Gene name
GNG5
- Application
-
Alternative Names
FLJ92393; GBG5_HUMAN; Gng5; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5; OTTHUMP00000011474; OTTHUMP00000011565
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63218
-
Expression Region
1-68aa
-
AA Sequence
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
-
Molecular Weight
33.22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNG5, also known as Guanine nucleotide-binding protein gamma-5, is part of the G protein family that plays a crucial role in various signal transduction pathways. Research into GNG5-recombinant proteins has gained momentum due to their potential implications in understanding cellular signaling mechanisms associated with various physiological and pathological processes. GNG5 is of particular interest because it forms complexes with G protein beta subunits, influencing numerous downstream signaling pathways, including those related to cardiovascular function, neurobiology, and cancer. Furthermore, major advances in biochemical techniques have enabled the production and purification of GNG5-recombinant proteins, facilitating detailed studies on their structural and functional properties. Investigations into GNG5 could provide insights into its role in signal transduction dysregulation, which is often implicated in diseases. The ability to generate GNG5 in a recombinant form also opens avenues for exploring its potential as a therapeutic target and for developing novel drug delivery systems that could modulate G protein signaling. Collectively, the study of GNG5-recombinant proteins not only enhances our understanding of G protein-coupled receptor systems but also contributes to the broader field of molecular biology and pharmacology, aligning with ongoing efforts to elucidate the complex networks governing cellular communication and therapeutic interventions.
