Analytical Data
-
Gene name
TCHH
- Application
-
Alternative Names
TCHH；THH；THL；TRHY；Trichohyalin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07283
-
Expression Region
1854-1943aa
-
AA Sequence
QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEYIQEQRSQYRP
-
Molecular Weight
18.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TCHH (Tachykinin-Related Peptide 1 Homolog) is a protein that belongs to a family of tachykinins, which are neuropeptides known for their roles in various physiological processes, including pain sensation, inflammation, and modulation of the immune response. Research into TCHH and its recombinant proteins has gained considerable attention due to its potential applications in therapeutic interventions. The protein is expressed in various tissues and is believed to engage in cell-signaling pathways, influencing numerous biological functions. Understanding TCHH's structure and function is crucial, as it might play a significant role in conditions like neurodegenerative diseases, where its dysregulation could have deleterious effects. The development of recombinant TCHH proteins allows researchers to explore its biological activity in detail, facilitating studies on its receptor interactions, signaling mechanisms, and potential as a biomarker. Additionally, the therapeutic potential of TCHH may include its use in pain management or as a target for drug development aimed at modulating the neuroimmune interactions. As a result, ongoing research focuses on elucidating the functional properties of TCHH, its expression patterns in various cell types, and the implications of its modulation in different disease contexts, which could pave the way for innovative therapeutic strategies.
