Analytical Data
-
Gene name
GNG3
- Application
-
Alternative Names
GBG3_HUMAN; GNG3; Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-3 subunit; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63215
-
Expression Region
1-75aa
-
AA Sequence
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
-
Molecular Weight
33.99 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNG3, or Guanine Nucleotide-Binding Protein Gamma 3, is a component of the G protein complex that plays a critical role in various signaling pathways, particularly those that mediate cellular responses to external stimuli. Research on GNG3 has gained importance due to its involvement in numerous physiological processes, such as hormone signaling, sensory perception, and the modulation of neurotransmitter systems. Abnormalities in GNG3 expression or function have been linked to several diseases, including cancer, neurological disorders, and metabolic syndromes, highlighting its potential as a therapeutic target. The study of GNG3 recombinant protein is pivotal for understanding its structural and functional properties, enabling researchers to dissect its role in cellular signaling more precisely. By producing GNG3 in a recombinant form, scientists can investigate its interactions with various receptors and downstream effectors in controlled experimental settings, thus providing insights into its mechanisms and potential implications in disease. Overall, GNG3 represents a significant area of investigation in molecular biology and pharmacology, as elucidating its function could pave the way for novel treatment strategies aimed at modulating G protein-coupled signaling pathways.
