Cat: PA2000-8004

Recombinant Human GNG3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GNG3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GBG3_HUMAN; GNG3; Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-3 subunit; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P63215

  • Expression Region

    1-75aa

  • AA Sequence

    MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL

  • Molecular Weight

    33.99 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GNG3, or Guanine Nucleotide-Binding Protein Gamma 3, is a component of the G protein complex that plays a critical role in various signaling pathways, particularly those that mediate cellular responses to external stimuli. Research on GNG3 has gained importance due to its involvement in numerous physiological processes, such as hormone signaling, sensory perception, and the modulation of neurotransmitter systems. Abnormalities in GNG3 expression or function have been linked to several diseases, including cancer, neurological disorders, and metabolic syndromes, highlighting its potential as a therapeutic target. The study of GNG3 recombinant protein is pivotal for understanding its structural and functional properties, enabling researchers to dissect its role in cellular signaling more precisely. By producing GNG3 in a recombinant form, scientists can investigate its interactions with various receptors and downstream effectors in controlled experimental settings, thus providing insights into its mechanisms and potential implications in disease. Overall, GNG3 represents a significant area of investigation in molecular biology and pharmacology, as elucidating its function could pave the way for novel treatment strategies aimed at modulating G protein-coupled signaling pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US