Analytical Data
-
Gene name
ECHS1
- Application
-
Alternative Names
ECHS1;Enoyl-CoA hydratase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30084
-
Expression Region
28-290aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPK ALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNL SFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGE KAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQA GLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGS KLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECHS1 (Enoyl-CoA hydratase 1) is a crucial enzyme involved in the mitochondrial metabolism of fatty acids, particularly in the degradation of medium-chain and long-chain fatty acids. Its role in the mitochondrial β-oxidation pathway highlights its importance in energy production and metabolic homeostasis. Mutations in the ECHS1 gene have been linked to various medical conditions, including mitochondrial disorders and neurological diseases, which underscore the significance of this enzyme in human health. The study of ECHS1 recombinant proteins enables researchers to better understand its structure and function, facilitating insights into the molecular mechanisms of fatty acid metabolism and the pathological consequences of ECHS1 deficiencies. These investigations are fundamental in developing targeted therapeutic strategies for metabolic disorders associated with ECHS1 dysfunction, and they pave the way for potential advancements in gene therapy and precision medicine. By analyzing the biophysical properties and enzymatic activity of recombinant ECHS1 proteins, researchers aim to elucidate its role in cellular metabolism, which could significantly contribute to our knowledge of mitochondrial function and its implications for diseases linked to mitochondrial dysfunction.
