Analytical Data
-
Gene name
DYRK1A
- Application
-
Alternative Names
DYRK1A；DYRK；MNB；MNBH;Dual specificity tyrosine-phosphorylation-regulated kinase 1A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13627
-
Expression Region
674-763aa
-
AA Sequence
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFS ANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DYRK1A (Dual-specificity tyrosine-phosphorylation regulated kinase 1A) is a serine/threonine kinase that has garnered significant attention due to its crucial role in various biological processes, including neurodevelopment, cellular differentiation, and the regulation of gene expression. Notably, DYRK1A is implicated in Down syndrome, as its gene is located on chromosome 21, which is triplicated in individuals with this condition. Elevated levels of DYRK1A have been linked to cognitive deficits and neurodevelopmental disorders. Research into the function of DYRK1A has revealed its involvement in cell cycle regulation and neuronal signaling pathways, suggesting that it may serve as a potential therapeutic target. The development of DYRK1A recombinant proteins allows for detailed biochemical and structural studies, enabling researchers to explore its enzymatic properties, substrate interactions, and regulatory mechanisms. Such studies could pave the way for novel interventions aimed at mitigating the effects of its dysregulation in diseases like Down syndrome and other neurodegenerative disorders. Understanding DYRK1A's structure and function through recombinant protein studies is thus critical for elucidating its role in health and disease, providing insights that could lead to the development of targeted therapies.
