Analytical Data
-
Gene name
DYNLRB2
- Application
-
Alternative Names
DYNLRB2;DNCL2B;DNLC2B;ROBLD2;Dynein light chain roadblock-type 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TF09
-
Expression Region
1-96aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPI RTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMV APDKEYLLIVIQNPCE
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DYNLRB2, a member of the dynein light chain family, plays a crucial role in intracellular transport processes by regulating the activity of dynein motor proteins. These motor proteins are essential for transporting cellular cargo along microtubules, contributing to various cellular functions, including mitosis, endocytosis, and organelle positioning. Recent studies have highlighted the importance of DYNLRB2 in neuronal cells, where it is implicated in the transport of vesicles and organelles necessary for synaptic function and maintenance. Dysregulation of DYNLRB2 has been associated with neurodegenerative diseases, underscoring its potential as a therapeutic target. The production of recombinant DYNLRB2 protein has become vital for exploring its structure-function relationship and its role in dynein-mediated transport. By utilizing recombinant DNA technology, researchers aim to elucidate the mechanistic pathways involving DYNLRB2 in cellular dynamics, potentially leading to novel interventions for conditions linked to dynein dysfunction. Consequently, understanding the properties and interactions of DYNLRB2 at the molecular level is essential to advancing our comprehension of motor protein biology and its implications in health and disease.











