Cat: PA2000-3692

Recombinant Human MT1G Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MT1G

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MT1G;MT1K;MT1M;Metallothionein-1G

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13640

  • Expression Region

    1-59aa

  • AA Sequence

    MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC

  • Molecular Weight

    32.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MT1G, or Metallothionein 1G, is a small, cysteine-rich protein that plays a crucial role in metal ion homeostasis and detoxification in various biological systems. Its expression is particularly influenced by environmental stressors such as heavy metals and oxidative stress. Research into MT1G has burgeoned due to its potential implications in cancer biology, neurodegenerative diseases, and other pathological conditions. Studies indicate that MT1G may function as a tumor suppressor by regulating zinc levels and protecting cells from oxidative damage. Moreover, altered expression of MT1G has been associated with various cancers, highlighting its potential as a biomarker for diagnosis and prognosis. Investigations into the recombinant production of MT1G have paved the way for better functional studies and therapeutic applications, enabling researchers to explore how modulation of this protein could influence disease outcomes and treatment strategies. Overall, the study of MT1G is integral to understanding metal ion metabolism and its implications in health and disease, making it a significant focus in molecular and clinical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US