Analytical Data
-
Gene name
MT1G
- Application
-
Alternative Names
MT1G;MT1K;MT1M;Metallothionein-1G
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13640
-
Expression Region
1-59aa
-
AA Sequence
MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
-
Molecular Weight
32.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MT1G, or Metallothionein 1G, is a small, cysteine-rich protein that plays a crucial role in metal ion homeostasis and detoxification in various biological systems. Its expression is particularly influenced by environmental stressors such as heavy metals and oxidative stress. Research into MT1G has burgeoned due to its potential implications in cancer biology, neurodegenerative diseases, and other pathological conditions. Studies indicate that MT1G may function as a tumor suppressor by regulating zinc levels and protecting cells from oxidative damage. Moreover, altered expression of MT1G has been associated with various cancers, highlighting its potential as a biomarker for diagnosis and prognosis. Investigations into the recombinant production of MT1G have paved the way for better functional studies and therapeutic applications, enabling researchers to explore how modulation of this protein could influence disease outcomes and treatment strategies. Overall, the study of MT1G is integral to understanding metal ion metabolism and its implications in health and disease, making it a significant focus in molecular and clinical research.











