Analytical Data
-
Gene name
RPA4
- Application
-
Alternative Names
RPA4；Replication Protein A 30 kDa subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13156
-
Expression Region
1-260aa
-
AA Sequence
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSA
-
Molecular Weight
32.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPA4, a subunit of the Replication Protein A (RPA) complex, plays a crucial role in DNA replication and repair processes. It is a single-stranded DNA-binding protein that is essential for maintaining genomic stability by protecting single-stranded DNA (ssDNA) and facilitating the repair of DNA damage. Research on RPA4 has gained significant attention due to its involvement in various cellular processes, including replication fork stabilization, DNA damage response, and the regulation of gene expression. Dysregulation of RPA components, including RPA4, has been implicated in several diseases, particularly cancer, where aberrant DNA repair mechanisms contribute to tumorigenesis. Moreover, RPA4's interaction with other proteins in the context of DNA repair pathways makes it a potential target for therapeutic intervention. The study of RPA4 not only enhances our understanding of fundamental biological processes but also paves the way for developing novel strategies to combat diseases associated with DNA repair deficiencies. Overall, RPA4 represents a significant focus in ongoing research aimed at elucidating its structural properties, functional roles, and potential applications in biotechnology and medicine.
