Analytical Data
-
Gene name
DUSP10
- Application
-
Alternative Names
DUSP10；MKP5;Dual specificity Protein phosphatase 10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6W6
-
Expression Region
1-140aa
-
AA Sequence
MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE FIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKR PIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DUSP10, or Dual Specificity Phosphatase 10, is a member of the dual-specificity phosphatase family, which plays a crucial role in regulating various signaling pathways by dephosphorylating both tyrosine and serine/threonine residues on target proteins. The research on DUSP10 has gained attention due to its involvement in several cellular processes, including cell proliferation, differentiation, and apoptosis, as well as its implications in diseases such as cancer and autoimmune disorders. Elevated levels of DUSP10 have been linked to poor patient outcomes in various cancers, suggesting its role as a potential biomarker and therapeutic target. Moreover, DUSP10 is known to modulate the MAPK signaling pathway, which is pivotal in cellular responses to extracellular stimuli. Understanding the structure, function, and regulatory mechanisms of DUSP10 can provide insights into its contribution to disease mechanisms and lead to the development of novel therapeutic strategies. Recent advancements in recombinant protein technology have facilitated the production and purification of DUSP10, allowing for detailed biochemical studies. These studies aim to elucidate its enzymatic activity, substrate specificity, and regulatory mechanisms, contributing valuable information to the field of signal transduction and therapeutic development. As researchers continue to unravel the complex roles of DUSP10, its potential as a drug target and biomarker remains a promising area of investigation in cancer research and beyond.
