Cat: PA2000-3669

Recombinant E.coli metC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    metC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    metC;Cystathionine beta-lyase MetC

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06721

  • Expression Region

    1-392aa

  • AA Sequence

    MADKKLDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVEAKKHATRNRA NGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQ GDHVLMTNTAYEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKI VFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWAAGVLFKALDFG IDVSIQAATKYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAY ITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPALPGSKGHEFW KRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILAN QPEHIAAIRPQGEIDFSGTLIRLHIGLEDVDDLIADLDAGFA

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The metC gene encodes a protein that plays a crucial role in the biosynthesis of the amino acid methionine, which is essential for various cellular functions, including protein synthesis and metabolism. Understanding the function and structure of the metC protein can provide valuable insights into the pathways involved in methionine production, which is significant for both basic biological research and industrial applications, such as fermentation processes and the production of amino acid supplements. The study of recombinant metC proteins allows researchers to elucidate the mechanisms of methionine biosynthesis and to explore potential applications in biotechnology, such as metabolic engineering strategies to enhance amino acid production in microbial systems. Furthermore, insights gained from the recombinant forms of metC can lead to the development of targeted approaches for improving crop resilience and nutrition in agricultural contexts. Given the essential nature of methionine in various organisms, investigating metC through recombinant protein studies serves as a foundation for advancing our understanding of amino acid metabolism and its implications across multiple fields, including health, nutrition, and biotechnology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US