Analytical Data
-
Gene name
DPPA3
- Application
-
Alternative Names
DPPA3；STELLAR;Developmental pluripotency-associated Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6W0C5
-
Expression Region
1-159aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMDPSQFNPTYIPGSPQMLTEENSRDDS GASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAVLREIEDE WLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKESR PFKCPCSFCVSNGWDPSENARIGNQDTKPLQP
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPPA3 (Developmental Pluripotency Associated 3) is a critical protein that plays a significant role in maintaining pluripotency, the ability of stem cells to develop into various cell types. Originally identified in embryonic stem cells, DPPA3 is involved in the regulation of genes that are essential for stem cell self-renewal and differentiation. Its expression is tightly regulated during early development and ismarker of pluripotent states in both embryonic and induced pluripotent stem cells (iPSCs). Research into DPPA3 has gained momentum in recent years due to its potential applications in regenerative medicine and developmental biology. The protein’s ability to modulate key signaling pathways makes it a promising target for enhancing stem cell therapies. Additionally, studying DPPA3's mechanistic role in cellular processes can provide insights into developmental disorders and cancers where pluripotent cells may play a crucial role. Thus, the characterization and understanding of DPPA3 as a recombinant protein is a focal point of current research efforts aimed at unlocking the therapeutic possibilities of stem cell technology.
