Cat: PA1000-909DB

Recombinant Human DNMT3L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DNMT3L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DNMT3L;DNA (cytosine-5)-methyltransferase 3-like

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UJW3

  • Expression Region

    1-386aa

  • AA Sequence

    MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIE DICICCGSLQVHTQHPLFEGGICAPCKDKFLDALFLYDDDGYQSYCSICC SGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNWVCYLCLPSSR SGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIK KELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGH TCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASR FLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL

  • Molecular Weight

    70 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DNMT3L (DNA methyltransferase 3-like protein) is a crucial regulator in the process of DNA methylation, which plays a significant role in epigenetic modifications that influence gene expression and developmental processes. Unlike other DNA methyltransferases, DNMT3L lacks catalytic activity but serves as an essential cofactor for DNMT3A and DNMT3B, promoting their activity in de novo methylation. The study of DNMT3L has gained prominence due to its involvement in gametogenesis, embryonic development, and potential implications in diseases such as cancer and genetic disorders. Research has revealed that DNMT3L is vital for normal spermatogenesis and oogenesis, and its aberrant expression has been linked to infertility and reproductive issues. Moreover, understanding the molecular mechanisms by which DNMT3L interacts with other proteins and DNA is critical for elucidating its role in establishing and maintaining methylation patterns. Recent advances in recombinant protein technology have enabled the production and characterization of DNMT3L, facilitating investigations into its structure-function relationships and biochemical properties. Overall, the exploration of DNMT3L not only enhances our comprehension of epigenetic regulation but also opens avenues for therapeutic strategies targeting epigenetic modifications in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US