Analytical Data
-
Gene name
CM1
- Application
-
Alternative Names
CM1；Keratin. type I cytoskeletal 13
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42738
-
Expression Region
3-247aa
-
AA Sequence
ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA
-
Molecular Weight
31.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTK2, also known as focal adhesion kinase (FAK), is a non-receptor tyrosine kinase that plays a crucial role in various cellular processes, including cell adhesion, migration, and survival. The study of PTK2 has gained significant attention due to its involvement in various diseases, particularly cancer, where it is often upregulated and contributes to tumor progression and metastasis. The mechanism of PTK2 activation and its downstream signaling pathways are essential for understanding how cells respond to external stimuli and interact with their microenvironment. Research into the recombinant expression of PTK2 allows scientists to produce large quantities of the protein for structural and functional studies, facilitating the elucidation of its biological roles. Understanding the structure of PTK2 through crystallography and other biophysical methods can provide insights into its function and regulation. Additionally, exploring PTK2's interactions with other signaling molecules is vital for identifying potential therapeutic targets. Given its significance in disease progression, PTK2 is a promising candidate for drug development, making the study of its recombinant protein particularly relevant for developing strategies to combat cancer and other diseases linked to dysregulated cell signaling. Overall, the research on PTK2 recombinant protein not only deepens our understanding of fundamental cellular processes but also holds potential for advancing therapeutic interventions.
