Analytical Data
-
Gene name
SPA17
- Application
-
Alternative Names
SPA17；SP17；Sperm surface Protein Sp17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15506
-
Expression Region
1-146aa
-
AA Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE
-
Molecular Weight
43.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPA17, an important protein associated with cellular processes, has garnered significant attention in the field of immunology and cell biology. It is primarily known for its role in the immune response and its involvement in various cellular signaling pathways. Research suggests that SPA17 may function as a regulator of immune cell activation and proliferation, making it a potential target for therapeutic interventions. The study of SPA17 has implications for understanding autoimmune diseases, cancer, and infectious diseases, where immune regulation is critical. Recent advancements in recombinant protein technology have enabled the production of SPA17 in a laboratory setting, allowing for detailed studies of its structure and function. Investigating SPA17's interactions with other proteins and its functional mechanisms could provide insights into its role in modulating immune responses. Furthermore, the potential application of SPA17 in vaccine development and immunotherapy highlights the importance of this protein in contemporary biomedical research. Overall, understanding SPA17's biochemical properties and physiological roles could pave the way for novel therapeutic strategies aimed at enhancing immune function or alleviating pathological immune responses.
