Analytical Data
-
Gene name
DNAJC15
- Application
-
Alternative Names
DNAJC15；DNAJD1;DnaJ homolog subfamily C member 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5T4
-
Expression Region
1-150aa
-
AA Sequence
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNAJC15 is a member of the DnaJ heat shock protein family, renowned for its role as a co-chaperone in protein folding and stress response. This protein is particularly significant in the context of mitochondrial function, where it is implicated in the maintenance of mitochondrial proteostasis and the prevention of stress-induced mitochondrial dysfunction. Recent studies have shown that mutations in the DNAJC15 gene are associated with distinct neurodegenerative diseases, highlighting its critical role in neuronal health. Researchers are increasingly interested in understanding the mechanisms by which DNAJC15 operates at the molecular level, including its interactions with other chaperones and its involvement in mitochondrial dynamics. Given that mitochondrial dysfunction is a common feature in various age-related diseases, the investigation of DNAJC15’s function could provide valuable insights into potential therapeutic targets for conditions such as Parkinson's disease and other mitochondrial disorders. Exploring the recombinant expression of DNAJC15 in model systems offers a promising approach to elucidate its biochemical properties and functional mechanisms, which may ultimately lead to novel strategies for therapeutic intervention.
