Cat: PA1000-849DB

Recombinant Human DDAH1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DDAH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DDAH1;DDAH;N(G).N(G)-dimethylarginine dimethylaminohydrolase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O94760

  • Expression Region

    1-285aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAGLGHPAAFGRATHAVVRALPESLGQ HALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFV EDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLD GGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSF CSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNI PNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSV LINKKVDS

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DDAH1 (Dimethylarginine Dimethylaminohydrolase 1) is an important enzyme that plays a critical role in the regulation of nitric oxide (NO) production in the body by metabolizing asymmetric dimethylarginine (ADMA), an endogenous inhibitor of nitric oxide synthase. Elevated levels of ADMA have been implicated in various cardiovascular diseases, including hypertension and atherosclerosis, making DDAH1 a potential therapeutic target for these conditions. Research into recombinant DDAH1 proteins has gained momentum as it offers insights into the enzyme's structural and functional properties, paving the way for developing novel interventions to modulate its activity. Expression and purification of recombinant DDAH1 enable detailed biochemical assays, facilitating the exploration of its activity under different physiological and pathological conditions. Furthermore, understanding the regulatory mechanisms and modulation of DDAH1 can lead to advances in the treatment of diseases related to NO dysfunction, enhancing cardiovascular health and potentially addressing other related disorders. As a result, the study of DDAH1 recombinant proteins not only contributes to fundamental biology but also holds promise for innovative therapeutic applications in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US