Analytical Data
-
Gene name
P2RY12
- Application
-
Alternative Names
P2RY12；HORK3；P2Y purinoceptor 12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H244
-
Expression Region
1-342aa
-
AA Sequence
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P2RY12, a purinergic receptor, plays a crucial role in various physiological processes, particularly in the regulation of platelet activation and signaling pathways associated with inflammatory responses. Research into P2RY12 has gained prominence due to its involvement in cardiovascular diseases, where it mediates the effects of adenosine diphosphate (ADP) in platelet aggregation. This receptor is a key target for antiplatelet therapies, such as clopidogrel, which are used to prevent thrombotic events. Understanding P2RY12's structure and function through the study of recombinant proteins is vital for the development of more effective therapeutics and for elucidating the receptor's role in disease mechanisms. Recombinant P2RY12 proteins enable researchers to investigate ligand-binding properties, receptor conformational changes, and downstream signaling pathways in a controlled environment. Furthermore, these studies can provide insights into the receptor’s interactions with various drugs and its contributions to platelet-related disorders, thus paving the way for new strategies in preventing and treating thromboembolic diseases. As research advances, the potential for P2RY12-targeted therapies continues to expand, aiming to improve clinical outcomes for patients at risk of cardiovascular incidents.
