Analytical Data
-
Gene name
CDO1
- Application
-
Alternative Names
CDO1;Cysteine dioxygenase type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16878
-
Expression Region
1-200aa
-
AA Sequence
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMY AKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQG NLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEP AVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDO1, or Cartilage Oligomeric Matrix Protein 1, is a member of the Cartilage Oligomeric Matrix Protein (COMP) family known to play a role in extracellular matrix organization and cellular signaling processes. The investigation of CDO1 recombination protein has gained significant attention due to its potential implications in various physiological and pathological processes, including cartilage development, tissue repair, and disease mechanisms such as osteoarthritis and cancer. Recent studies have highlighted the importance of CDO1 in regulating chondrocyte function and modulating inflammatory responses, suggesting a pivotal role in maintaining cartilage homeostasis. Furthermore, alterations in CDO1 expression and function have been linked to impaired regeneration and the progression of degenerative diseases, prompting researchers to explore its therapeutic potential. Understanding the structural and functional characteristics of CDO1, particularly through recombinant protein studies, could pave the way for innovative strategies in regenerative medicine and targeted therapies. These studies not only provide insights into CDO1's biological roles but also contribute to the broader understanding of extracellular matrix interactions within the cellular microenvironment. By utilizing techniques such as protein expression, purification, and functional assays, researchers aim to elucidate the mechanisms by which CDO1 contributes to tissue dynamics and disease pathology. This growing body of research underscores the significance of CDO1 as a critical player in matrix biology, offering new avenues for intervention in connective tissue disorders and enhancing our comprehension of molecular pathways involved in health and disease.
