Analytical Data
-
Gene name
UCN3
- Application
-
Alternative Names
UCN3；SPC；Urocortin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969E3
-
Expression Region
119-161aa
-
AA Sequence
KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
-
Molecular Weight
20.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCN3 (Urocortin 3) is a neuropeptide belonging to the corticotropin-releasing factor (CRF) family, which plays a crucial role in the central nervous system and various physiological processes, including stress response, appetite regulation, and cardiovascular functions. The study of UCN3 recombinant proteins has gained increasing attention due to their potential therapeutic implications in psychiatric disorders and metabolic syndrome. Recent research indicates that UCN3 interacts with specific receptors, primarily CRF receptor subtypes, influencing neuronal signaling pathways and behavioral responses. By producing recombinant UCN3, scientists aim to investigate its structural properties, functional mechanisms, and interactions with other proteins, paving the way for potential applications in drug development. Understanding the role of UCN3 in health and disease could lead to novel strategies for treating anxiety, depression, and obesity-related conditions, thereby highlighting the significance of this peptide in biomedical research. Through advanced techniques such as crystallography and molecular modeling, researchers are working to elucidate the three-dimensional structure of UCN3, which is essential for designing drugs that can mimic or modulate its activity. Overall, the study of UCN3 recombinant protein represents a promising frontier in neurobiology and pharmacology, with implications for improving mental health and addressing metabolic disorders.
