Analytical Data
-
Gene name
GUCA2B
- Application
-
Alternative Names
GUCA2B；Guanylate cyclase activator 2B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16661
-
Expression Region
27-112aa
-
AA Sequence
VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
-
Molecular Weight
11.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCA2B, a member of the guanylate cyclase-activating protein family, has garnered attention due to its role in the physiological functions of retinal photoreceptor cells. This protein is primarily expressed in the retina, where it is believed to play a crucial role in the phototransduction pathway, modulating the activity of guanylate cyclase and thereby influencing cyclic GMP levels. Dysregulation of GUCA2B has been implicated in various retinal disorders, including photoreceptor degeneration and conditions like retinitis pigmentosa. Research on GUCA2B recombinant protein has gained momentum as scientists aim to elucidate its structural characteristics and functional mechanisms. By producing GUCA2B in a recombinant form, researchers can investigate its interactions with guanylate cyclase and other signaling molecules, paving the way for potential therapeutic strategies. Understanding the role of GUCA2B not only contributes to the fundamental knowledge of retinal biology but also opens avenues for developing treatments for retinal diseases, underscoring the importance of this protein in vision science.
