Analytical Data
-
Gene name
H2BC4
- Application
-
Alternative Names
H2BC4；H2BFL；HIST1H2BC；H2BC6；Histone H2B type 1-C/E/F/G/I
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62807
-
Expression Region
2-125aa
-
AA Sequence
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
-
Molecular Weight
40.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H2BC4, also known as Histone H2B Cluster 4, is a member of the histone family and plays a crucial role in the regulation of gene expression and chromatin structure. As a core component of the linker histone H2B, H2BC4 is significantly involved in the packaging of DNA into nucleosomes, thereby influencing DNA accessibility for transcription, replication, and repair. Recent studies have highlighted the importance of histone variants like H2BC4 in various biological processes, including cellular differentiation, proliferation, and response to environmental stimuli. Moreover, aberrations in histone modifications and expression, including H2BC4, have been implicated in several diseases, notably cancer, where their altered expression patterns can lead to dysregulation of key oncogenes and tumor suppressor genes. Understanding the functional mechanisms and regulatory networks of H2BC4 is critical for deciphering its role in oncogenesis and exploring potential therapeutic targets. This has prompted extensive research into H2BC4, focusing on its structure, post-translational modifications, and interactions with other nuclear proteins, with the aim of elucidating its contribution to chromatin dynamics and cellular homeostasis. Overall, the investigation of H2BC4 not only sheds light on fundamental biological processes but also offers insights into the complexities of epigenetic regulation and its implications for health and disease.
