Analytical Data
-
Gene name
IFITM1
- Application
-
Alternative Names
IFITM1;CD225;IFI17;Interferon-induced transmembrane Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13164
-
Expression Region
1-125aa
-
AA Sequence
MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWC CLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGF ILLLVFGSVTVYHIMLQIIQEKRGY
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IFITM1, or Interferon-Inducible Transmembrane Protein 1, is a small membrane protein primarily studied for its role in the innate immune response. It has garnered attention due to its ability to restrict viral infections, particularly those caused by enveloped viruses such as HIV, influenza, and Ebola. IFITM1 is induced by interferons during viral infections, highlighting its significance as a part of the body's first line of defense against pathogens. Research has shown that IFITM1 functions by altering membrane dynamics and preventing viral fusion, thereby inhibiting the entry of viruses into host cells. Furthermore, its expression levels are associated with the progression of certain cancers, where it may influence tumor cell proliferation and metastasis. This dual role in both antiviral defense and cancer biology makes IFITM1 a compelling target for therapeutic intervention. Recent studies have focused on the detailed mechanisms of IFITM1 action, exploring its molecular interactions, structural characteristics, and potential for drug development. Understanding the role of IFITM1 in viral pathogenesis and tumor biology could pave the way for novel antiviral strategies and cancer therapies, underscoring the importance of continued research in this field.











