Cat: PA2000-3564

Recombinant Human IFITM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IFITM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IFITM1;CD225;IFI17;Interferon-induced transmembrane Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13164

  • Expression Region

    1-125aa

  • AA Sequence

    MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWC CLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGF ILLLVFGSVTVYHIMLQIIQEKRGY

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IFITM1, or Interferon-Inducible Transmembrane Protein 1, is a small membrane protein primarily studied for its role in the innate immune response. It has garnered attention due to its ability to restrict viral infections, particularly those caused by enveloped viruses such as HIV, influenza, and Ebola. IFITM1 is induced by interferons during viral infections, highlighting its significance as a part of the body's first line of defense against pathogens. Research has shown that IFITM1 functions by altering membrane dynamics and preventing viral fusion, thereby inhibiting the entry of viruses into host cells. Furthermore, its expression levels are associated with the progression of certain cancers, where it may influence tumor cell proliferation and metastasis. This dual role in both antiviral defense and cancer biology makes IFITM1 a compelling target for therapeutic intervention. Recent studies have focused on the detailed mechanisms of IFITM1 action, exploring its molecular interactions, structural characteristics, and potential for drug development. Understanding the role of IFITM1 in viral pathogenesis and tumor biology could pave the way for novel antiviral strategies and cancer therapies, underscoring the importance of continued research in this field.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US