Analytical Data
-
Gene name
PPP2CB
- Application
-
Alternative Names
PPP2CB；Serine/threonine-Protein phosphatase 2A catalytic subunit beta isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62714
-
Expression Region
1-309aa
-
AA Sequence
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
-
Molecular Weight
59 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP2CB, or protein phosphatase 2 regulatory subunit B beta, plays a critical role in various cellular processes by regulating protein phosphorylation, which is essential for signal transduction, cell cycle regulation, and metabolic pathways. The study of PPP2CB has gained significant attention due to its involvement in several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Abnormal activity or expression of PPP2CB can lead to dysregulation of the phosphatase activity, contributing to tumor progression and resistance to therapies. Researchers are focused on understanding the structure-function relationships of PPP2CB, particularly its restructured proteins, to elucidate the underlying mechanisms of its regulatory role. Characterizing recombined forms of PPP2CB can help in identifying potential therapeutic targets and developing strategies for disease intervention. The detailed investigation of its interactions with other proteins and signaling pathways further underscores the potential of PPP2CB as a biomarker for disease diagnostics and a target for drug development. Studies involving restructured PPP2CB proteins are therefore essential for advancing our understanding of its biological functions and implications in health and disease.
