Analytical Data
-
Gene name
RPS19BP1
- Application
-
Alternative Names
RPS19BP1；AROS；Active regulator of SIRT1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WX3
-
Expression Region
1-145aa
-
AA Sequence
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
-
Molecular Weight
42.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPS19BP1, a protein associated with ribosomal biology, has garnered attention due to its potential role in ribosome synthesis and the regulation of cell proliferation. This protein, a homolog of the RPS19 gene, is hypothesized to be involved in the maturation process of ribosomal RNA and the assembly of ribosomal subunits. Abnormalities or mutations in proteins related to ribosomal biogenesis are implicated in various diseases, including cancer and Diamond-Blackfan anemia (DBA), a genetic disorder characterized by a failure to produce enough red blood cells. Research into RPS19BP1 is crucial as understanding its structure and function could provide insights into the mechanisms of ribosome assembly and the pathways that lead to these diseases. Furthermore, recombinant protein technology allows for the production and study of RPS19BP1 in controlled laboratory settings, facilitating investigations into its biochemical properties, interactions with other cellular components, and its role in the stress responses of cells. As studies progress, insights gained from RPS19BP1 research may contribute to the development of targeted therapies for ribosome-related diseases, underscoring the importance of this protein in both basic research and clinical applications.
