Cat: PA1000-784DB

Recombinant Human CTSZ Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTSZ

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CTSZ;Cathepsin Z

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBR2

  • Expression Region

    24-303aa

  • AA Sequence

    GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDG VNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNV IDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTC NEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLA NYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWL RIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CTSZ, or Cathepsin Z, is a member of the cathepsin family of cysteine proteases, which play crucial roles in various biological processes, including protein catabolism, antigen processing, and cell signaling. The study of CTSZ has garnered significant interest due to its involvement in several pathological conditions, such as cancer, neurodegenerative diseases, and autoimmune disorders. Dysregulation of CTSZ activity has been linked to tumor progression and metastasis, making it a potential biomarker and therapeutic target for cancer treatment. Additionally, CTSZ plays a role in the immune response, providing insights into its function in inflammation and immune regulation. Researchers are increasingly focused on characterizing CTSZ through recombinant protein techniques to elucidate its structure, function, and interactions with other biomolecules. By producing and studying recombinant CTSZ, scientists aim to understand its enzymatic mechanisms and explore its potential as a target for innovative therapeutic strategies. The ongoing investigation into CTSZ reaffirms its significance in health and disease, paving the way for novel diagnostic and treatment approaches in various medical fields.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US