Analytical Data
-
Gene name
CTSZ
- Application
-
Alternative Names
CTSZ;Cathepsin Z
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBR2
-
Expression Region
24-303aa
-
AA Sequence
GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDG VNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNV IDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTC NEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLA NYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWL RIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSZ, or Cathepsin Z, is a member of the cathepsin family of cysteine proteases, which play crucial roles in various biological processes, including protein catabolism, antigen processing, and cell signaling. The study of CTSZ has garnered significant interest due to its involvement in several pathological conditions, such as cancer, neurodegenerative diseases, and autoimmune disorders. Dysregulation of CTSZ activity has been linked to tumor progression and metastasis, making it a potential biomarker and therapeutic target for cancer treatment. Additionally, CTSZ plays a role in the immune response, providing insights into its function in inflammation and immune regulation. Researchers are increasingly focused on characterizing CTSZ through recombinant protein techniques to elucidate its structure, function, and interactions with other biomolecules. By producing and studying recombinant CTSZ, scientists aim to understand its enzymatic mechanisms and explore its potential as a target for innovative therapeutic strategies. The ongoing investigation into CTSZ reaffirms its significance in health and disease, paving the way for novel diagnostic and treatment approaches in various medical fields.
