Analytical Data
-
Gene name
DDX39B
- Application
-
Alternative Names
DDX39B;BAT1;UAP56;Spliceosome RNA helicase DDX39B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13838
-
Expression Region
2-251aa
-
AA Sequence
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX39B, a member of the DEAD-box RNA helicase family, plays a crucial role in various cellular processes, including mRNA splicing, translation, and ribosome biogenesis. This protein is characterized by its ATP-dependent RNA unwinding activities, which are vital for the regulation of gene expression and the modulation of RNA metabolism. Recent studies have indicated that DDX39B is involved in the development and progression of certain cancers, making it a potential biomarker and therapeutic target. The investigation of recombinant DDX39B protein is essential for understanding its structure-function relationship, as well as its interactions with RNA and other regulatory proteins. By producing and studying this recombinant protein, researchers aim to elucidate the mechanistic pathways through which DDX39B operates, contributing to a deeper understanding of its role in health and disease. Moreover, insights gained from this research could pave the way for developing novel strategies to manipulate DDX39B activity, offering potential therapeutic avenues for diseases associated with its dysregulation.











