Analytical Data
-
Gene name
CTSS
- Application
-
Alternative Names
CTSS;Cathepsin S
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25774
-
Expression Region
1-331aa
-
AA Sequence
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRL IWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQ WQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEA QLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDS DASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSV GVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTSS (cathepsin S) is a cysteine protease that plays a crucial role in various physiological and pathological processes, including immune response, inflammation, and cancer progression. It is primarily expressed in antigen-presenting cells, where it contributes to the processing of protein antigens for presentation on major histocompatibility complex (MHC) molecules. This function is vital for the activation of CD4+ T cells and thereby influences adaptive immunity. Dysregulation of CTSS has been implicated in a range of diseases, notably autoimmune disorders and tumors, making it a target for therapeutic intervention. Moreover, CTSS has been studied for its potential utility as a biomarker for certain diseases due to its differential expression patterns in various conditions. Recent advancements in recombinant protein technology have facilitated the production of CTSS in a controlled laboratory setting, enabling detailed studies of its structure-function relationship and enzymatic mechanisms. Understanding the biological roles of CTSS and developing recombinant forms have significant implications for drug design, vaccine development, and therapeutic strategies aimed at modulating immune responses. Research on CTSS thus presents a promising avenue for enhancing our comprehension of immune regulation and cancer biology.











