Analytical Data
-
Gene name
ILF2
- Application
-
Alternative Names
ILF2；NF45；Interleukin enhancer-binding factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12905
-
Expression Region
1-390aa
-
AA Sequence
MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDE TSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIE EVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQD PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQS ALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH YAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT VMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE
-
Molecular Weight
70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ILF2 (Interleukin Enhancer Binding Factor 2) is an essential protein involved in post-transcriptional regulation of gene expression, particularly in the context of mRNA metabolism and stability. It is known to interact with specific RNA elements, facilitating various biological processes such as immune responses and cellular stress responses. Recent studies have indicated that ILF2 may play a critical role in cancer progression and metastasis, as aberrant expression levels of this protein are often associated with poor prognosis in various malignancies. Given its significant role in regulating gene expression, the recombinant production of ILF2 is crucial for detailed mechanistic studies, enabling researchers to dissect its functional dynamics in cellular processes. By expressing ILF2 in heterologous systems, scientists aim to explore its structure-function relationship, elucidate its binding interactions with RNA, and identify potential post-translational modifications that may influence its activity. Moreover, understanding the molecular mechanisms by which ILF2 contributes to pathological states could pave the way for novel therapeutic strategies targeting its function, highlighting the relevance of recombinant ILF2 proteins in both basic research and clinical applications. This foundation sets the stage for innovative approaches to harness ILF2's regulatory capabilities for therapeutic interventions, potentially leading to breakthroughs in managing diseases characterized by dysregulated gene expression.
