Cat: PA2000-3541

Recombinant Human Efemp1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Efemp1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Efemp1;FBLN3;FBNL;EGF-containing fibulin-like extracellular matrix Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q12805

  • Expression Region

    1-493aa

  • AA Sequence

    MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVGQQCKDIDECDI VPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTG VVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIRRNPADPQRIP SNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQ CPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNY TCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSI RSDRSVPSDIFQIQATTIYANTINTFRIKSGSENGEFYLRQTSPVSAMLV LVKSLSGPREHIVDLEMLTASSIGTFRTSSVLRLTIIVGPFSF

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Efemp1, or EGFR-pathway-regulated protein 1, is a protein that plays a critical role in cellular processes, including cell growth, differentiation, and apoptosis. It has garnered attention due to its association with various diseases, particularly in the context of cancer and age-related macular degeneration (AMD). Research indicates that the expression of Efemp1 is regulated by the epidermal growth factor receptor (EGFR) signaling pathway, which is a key player in tumor progression and resistance to therapy. The understanding of Efemp1’s functional mechanisms could provide insights into its role in disease pathogenesis, potentially identifying it as a therapeutic target. Recombinant Efemp1 protein has been developed to facilitate in-depth studies of its biological functions and interactions in vitro and in vivo. This recombinant protein allows researchers to explore the molecular pathways influenced by Efemp1, assess its impact on tumor cell behavior, and evaluate its potential as a biomarker for specific cancers or AMD. The elucidation of Efemp1’s structure and function, coupled with the advancement of techniques in protein engineering, paves the way for innovative approaches in drug design and therapeutic interventions. As research progresses, understanding the implications of Efemp1 in disease contexts may lead to new strategies for diagnosis and treatment, highlighting its significance in both basic and translational research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US