Cat: PA1000-757DB

Recombinant Human CSTB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSTB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CSTB;CST6;STFB;Cystatin-B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04080

  • Expression Region

    1-98aa

  • AA Sequence

    MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

  • Molecular Weight

    38.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSTB (Cystatin B) is a cysteine protease inhibitor that plays a crucial role in regulating proteolytic activity within the central nervous system. Its significance has been underscored by research linking CSTB mutations to neurological disorders, including the neurodegenerative condition Uncinate Focal Epilepsy, characterized by refractory seizures. Studies show that CSTB is involved in neuroinflammatory processes and neuronal cell death, indicating its potential as a therapeutic target. The production of recombinant CSTB proteins has become essential for understanding their biological functions and interactions at the molecular level. By utilizing techniques such as recombinant DNA technology, researchers can investigate CSTB's structure and mechanism of action, providing insights into its role in brain pathology and the potential development of novel therapeutic strategies. Additionally, characterizing CSTB as a recombinant protein allows for biochemical assays and the exploration of its involvement in protease-related diseases, paving the way for advances in treatments for neurodegenerative diseases and other conditions linked to proteolytic dysregulation. Overall, the research surrounding CSTB recombinant proteins is vital, as it not only enhances our understanding of its physiological functions but also contributes to broader insights in the field of neurobiology and potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US