Analytical Data
-
Gene name
GINS2
- Application
-
Alternative Names
GINS2；PSF2；DNA replication complex GINS Protein PSF2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y248
-
Expression Region
1-185aa
-
AA Sequence
MASMTGGQQMGRGEFGSMDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDL GPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEET FTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSAD SFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQ DF
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GINS2, a crucial component of the GINS complex, plays a significant role in eukaryotic DNA replication. The GINS complex comprises four proteins—GINS1, GINS2, GINS3, and GINS4—forming a tetrameric structure essential for the function of the DNA helicase complex. Specifically, GINS2 is known to interact with the MCM (minichromosome maintenance) helicase and the DNA polymerase ε, thereby facilitating the loading of DNA helicases onto replication origins and promoting the unwinding of DNA strands during replication. Research on recombinant GINS2 proteins has garnered interest due to their potential implications in understanding the mechanistic details of DNA replication fidelity and its regulation. Aberrant GINS2 function has been correlated with various cancers, highlighting its importance in maintaining genomic stability. The production and characterization of recombinant GINS2 not only provide insights into its biochemical properties and interactions but also pave the way for exploring targeted therapeutic strategies that can modulate DNA replication processes in pathological conditions. As such, investigating GINS2 through recombinant techniques is a critical step in elucidating its role in the intricate choreography of DNA replication and its implications in health and disease.
