Analytical Data
-
Gene name
CRYGS
- Application
-
Alternative Names
CRYGS;CRYG8;Gamma-crystallin S
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22914
-
Expression Region
2-178aa
-
AA Sequence
SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE
-
Molecular Weight
47.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRYGS, or crystal structure of guanosine triphosphate synthase, is a crucial enzyme involved in the synthesis of guanine nucleotides, which are essential for various biochemical processes, including DNA and RNA synthesis, cell signaling, and energy metabolism. As a member of the ATP/GTP-binding protein family, CRYGS plays a vital role in cellular functions. The study of CRYGS recombinant proteins has garnered significant attention in recent years due to its potential applications in biotechnology and medicine. Understanding the structure and function of CRYGS can provide insights into its regulatory mechanisms and interactions with various ligands. Moreover, studying the recombinant protein can facilitate the development of targeted therapies for diseases linked with nucleotide metabolism disorders, including certain cancers and neurodegenerative conditions. Research efforts have focused on the expression, purification, and characterization of CRYGS recombinant proteins, utilizing advanced techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. These studies not only enhance our comprehension of CRYGS's enzymatic activity but also pave the way for drug design and the discovery of novel inhibitors. Consequently, the investigation of CRYGS recombinant proteins is pivotal in unlocking new therapeutic strategies and understanding fundamental biological processes.











