Cat: PA1000-728DB

Recombinant Human CRYGS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRYGS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRYGS;CRYG8;Gamma-crystallin S

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22914

  • Expression Region

    2-178aa

  • AA Sequence

    SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE

  • Molecular Weight

    47.9kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRYGS, or crystal structure of guanosine triphosphate synthase, is a crucial enzyme involved in the synthesis of guanine nucleotides, which are essential for various biochemical processes, including DNA and RNA synthesis, cell signaling, and energy metabolism. As a member of the ATP/GTP-binding protein family, CRYGS plays a vital role in cellular functions. The study of CRYGS recombinant proteins has garnered significant attention in recent years due to its potential applications in biotechnology and medicine. Understanding the structure and function of CRYGS can provide insights into its regulatory mechanisms and interactions with various ligands. Moreover, studying the recombinant protein can facilitate the development of targeted therapies for diseases linked with nucleotide metabolism disorders, including certain cancers and neurodegenerative conditions. Research efforts have focused on the expression, purification, and characterization of CRYGS recombinant proteins, utilizing advanced techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. These studies not only enhance our comprehension of CRYGS's enzymatic activity but also pave the way for drug design and the discovery of novel inhibitors. Consequently, the investigation of CRYGS recombinant proteins is pivotal in unlocking new therapeutic strategies and understanding fundamental biological processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US