Cat: PA1000-9397

Recombinant Human LPAR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LPAR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LPAR1;EDG2;LPA1;Lysophosphatidic acid receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92633

  • Expression Region

    1-364aa

  • AA Sequence

    MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSK LVMGLGITVCIFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGL AYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLLAIAIERHITV FRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAP LYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNR DTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNH TILAGVHSNDHSVV

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LPAR1, or Lysophosphatidic Acid Receptor 1, is a G-protein-coupled receptor that plays a crucial role in various physiological and pathological processes, including cell proliferation, survival, migration, and differentiation. It is activated by lysophosphatidic acid (LPA), a bioactive lipid involved in several cellular signaling pathways. Significant research has linked LPAR1 to conditions such as cancer, fibrosis, and neurodegenerative diseases, highlighting its potential as a therapeutic target. Due to its involvement in disease progression, the characterization and production of LPAR1 recombinant proteins are of great interest. By utilizing techniques such as molecular cloning and expression in suitable host systems, researchers aim to produce functional LPAR1 proteins for structural and functional studies. These studies are vital for understanding the receptor's signaling mechanisms, interaction with ligands, and potential modulation by small molecules. Furthermore, LPAR1's role in promoting tumor growth and metastasis has made it a focus in cancer research, leading to the exploration of LPAR1 antagonists as novel cancer therapies. Overall, the investigation of LPAR1, particularly through the development of recombinant proteins, serves as a foundation for both basic research and the advancement of therapeutic strategies targeting various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US