Cat: PA1000-716DB

Recombinant Human CRMP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CRMP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CRMP1;DPYSL1;ULIP3;Dihydropyrimidinase-related Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14194

  • Expression Region

    1-572aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSEFMSYQGKKSIPHITSDRLLIKGGRII NDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTY LQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHE AADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQ MSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHAL SRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVF GEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGD LQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKM DENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSH KSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFP EHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSK HQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRMP1 (Collapsin Response Mediator Protein 1) is a pivotal protein involved in neuronal development and axon guidance. A member of the CRMP family, CRMP1 has garnered significant interest due to its role in neurotrophic signaling and its implications in neurodegenerative disorders. Research indicates that CRMP1 interacts with various signaling pathways, influencing cytoskeletal dynamics and neuronal differentiation. Its involvement in the growth cone dynamics of developing neurons highlights its potential as a target for therapeutic strategies aimed at facilitating nerve regeneration. Furthermore, studies have implicated CRMP1 in the pathology of conditions such as Alzheimer’s disease, where its dysregulation may contribute to neuroinflammation and synaptic dysfunction. The need to understand CRMP1's structure and function has fueled the production of recombinant CRMP1 protein, which serves as a valuable tool for elucidating its biological activities and interactions within cellular contexts. By employing recombinant technology, researchers aim to dissect the molecular mechanisms underlying CRMP1’s roles in neuronal signaling and its potential in therapeutic interventions for neurodegenerative diseases. The recombinant CRMP1 protein can further assist in screening for compounds that might modulate its function, thereby advancing drug discovery efforts in neuroprotection and neuroregeneration. Overall, the study of CRMP1, through the lens of recombinant protein research, holds promise for unveiling new avenues in neuroscience and for developing innovative therapeutic approaches to tackle complex neural disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US