Analytical Data
-
Gene name
CRKL
- Application
-
Alternative Names
CRKL;Crk-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46109
-
Expression Region
1-303aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSSARFDSSDRSAWYMGPVSRQEAQTRLQG QRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRRFKIGDQEFDH LPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRT LYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPL PSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN GRKGLFPFTHVKIFDPQNPDENE
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRKL (C-terminus of the CRK-like protein) is an adaptor protein that plays a crucial role in various cellular processes, including signal transduction, cytoskeletal organization, and cell migration. It contains two SH2 (Src Homology 2) domains and one SH3 (Src Homology 3) domain, allowing it to interact with various signaling molecules and participate in the regulation of cellular responses to external stimuli. Research into CRKL has gained momentum due to its association with several cancers, including leukemia and breast cancer, where it is often involved in the transformation and survival of malignant cells. The understanding of CRKL's molecular mechanisms and pathways is essential for developing targeted therapies. Additionally, the production and characterization of recombinant CRKL protein have become pivotal for elucidating its functional roles in signal transduction pathways. This protein can be utilized in various biochemical assays to study its interactions and regulatory mechanisms. Advances in recombinant DNA technology and protein expression systems have enabled researchers to produce high-purity CRKL, facilitating detailed structural and functional studies. By investigating the properties and interactions of CRKL, scientists aim to uncover its potential as a therapeutic target and to develop novel strategies for cancer treatment. The ongoing research into the recombinant CRKL protein underscores the importance of understanding its function in normal cellular physiology and its implications in disease progression.
