Cat: PA1000-9393

Recombinant Human PZP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PZP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PZP;CPAMD6;Pregnancy zone Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20742

  • Expression Region

    603-829aa

  • AA Sequence

    MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIY VPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYG AGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAV NSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVEL TMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSE QLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVL FAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PZP, or Pseudo-Zn1 protein, has garnered significant attention in recent biomedical research due to its unique structural characteristics and potential applications. Initially identified as a key component in the regulation of zinc homeostasis within cellular environments, PZP exhibits a complex folding pattern that suggests a role in various physiological processes, including enzyme activity and signal transduction. Researchers have been particularly interested in its ability to interact with a multitude of other proteins, indicating a possible function in cellular signaling networks and pathological conditions, such as cancer and neurodegenerative diseases. Additionally, the recombinant expression of PZP has enabled scientists to study its properties in detail, facilitating the exploration of its potential as a therapeutic target or biomarker. With advancements in protein engineering and characterization techniques, ongoing studies aim to unravel the molecular mechanisms underlying PZP's biological activities, which could lead to innovative strategies in drug development and disease management. As the understanding of PZP's role in human health deepens, it promises to contribute significantly to our knowledge of protein interactions and their implications in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US