Analytical Data
-
Gene name
CPOX
- Application
-
Alternative Names
CPOX；CPO；CPX;Oxygen-dependent coproporphyrinogen-III oxidase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36551
-
Expression Region
111-454aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSTSLGRPEEEEDELAHRCSSFMAPPVTD LGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGG GGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLP FCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTY LNQEDAVHFHRTLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGI FFDDLDSPSKEEVFRFVQSCARAVVPSYIPLVKKHCDDSFTPQEKLWQQL RRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS KEAEILEVLRHPRDWVR
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CPOX (Coproporphyrinogen oxidase) is a critical enzyme involved in the heme biosynthesis pathway, catalyzing the conversion of coproporphyrinogen III to protoporphyrinogen IX. Mutations in the CPOX gene can lead to hereditary coproporphyria, a condition characterized by the accumulation of porphyrins, which can result in severe neurological and gastrointestinal disturbances. Given the importance of heme in cellular metabolism and the potential impact of CPOX mutations on human health, extensive research has been dedicated to understanding the structure and function of the CPOX protein. Recombination technologies have enabled the production of CPOX as a recombinant protein, providing a valuable tool for biochemical studies. Investigating the protein’s enzymatic activity, regulatory mechanisms, and interaction with substrates and inhibitors are essential to elucidate its role in heme synthesis and to develop potential therapeutic strategies for porphyrias. Furthermore, understanding the structural dynamics of CPOX contributes to the broader field of protein engineering and offers insights into the design of novel biomolecules with applications in biomedicine and biotechnology. As recombinant CPOX becomes increasingly accessible, it is expected to serve as a basis for advancements in the diagnosis and treatment of related disorders, ultimately enhancing our understanding of porphyrin metabolism and its implications for human health.
