Analytical Data
-
Gene name
COPS8
- Application
-
Alternative Names
COPS8;CSN8;COP9 signalosome complex subunit 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99627
-
Expression Region
1-209aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPVAVMAESAFSFKKLLDQCENQELEAPGG IATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQR IWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIA DDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFI PLSEPAPVPPIPNEQQLARLTDYVAFLEN
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COPS8, also known as COP9 signalosome complex subunit 8, is a crucial component of the COP9 signalosome, a multi-subunit protein complex involved in various cellular processes, including signal transduction, protein degradation, and regulation of the cell cycle. The COP9 signalosome plays a role similar to the ubiquitin-proteasome system, but instead of marking proteins for degradation, it regulates their stability and activity through deubiquitination and post-translational modifications. Recent studies have highlighted the importance of COPS8 in maintaining cellular homeostasis and its involvement in various diseases, including cancer and neurodegenerative disorders. The dysregulation of COPS8 has been linked to abnormalities in signaling pathways that control cell proliferation and apoptosis, making it a potential target for therapeutic interventions. Additionally, understanding the structure and function of COPS8 could provide insights into the mechanisms underlying its role within the signalosome and its impact on cellular functions. As researchers continue to explore the functional implications of COPS8, the development of COPS8 recombinant proteins for biochemical studies has gained traction, enabling detailed investigations into its interactions and regulatory mechanisms, ultimately contributing to the broader understanding of cellular signaling and disease processes.











